Skip to main content
  • AACR Journals
    • Blood Cancer Discovery
    • Cancer Discovery
    • Cancer Epidemiology, Biomarkers & Prevention
    • Cancer Immunology Research
    • Cancer Prevention Research
    • Cancer Research
    • Clinical Cancer Research
    • Molecular Cancer Research
    • Molecular Cancer Therapeutics

AACR logo

  • Register
  • Log in
  • Log out
  • My Cart
Advertisement

Main menu

  • Home
  • About
    • The Journal
    • AACR Journals
    • Subscriptions
    • Permissions and Reprints
  • Articles
    • OnlineFirst
    • Current Issue
    • Past Issues
    • Meeting Abstracts
    • Collections
      • COVID-19 & Cancer Resource Center
      • Focus on Radiation Oncology
      • Novel Combinations
      • Reviews
      • Editors' Picks
      • "Best of" Collection
  • First Disclosures
  • For Authors
    • Information for Authors
    • Author Services
    • Best of: Author Profiles
    • Submit
  • Alerts
    • Table of Contents
    • Editors' Picks
    • OnlineFirst
    • Citation
    • Author/Keyword
    • RSS Feeds
    • My Alert Summary & Preferences
  • News
    • Cancer Discovery News
  • COVID-19
  • Webinars
  • Search More

    Advanced Search

  • AACR Journals
    • Blood Cancer Discovery
    • Cancer Discovery
    • Cancer Epidemiology, Biomarkers & Prevention
    • Cancer Immunology Research
    • Cancer Prevention Research
    • Cancer Research
    • Clinical Cancer Research
    • Molecular Cancer Research
    • Molecular Cancer Therapeutics

User menu

  • Register
  • Log in
  • Log out
  • My Cart

Search

  • Advanced search
Molecular Cancer Therapeutics
Molecular Cancer Therapeutics
  • Home
  • About
    • The Journal
    • AACR Journals
    • Subscriptions
    • Permissions and Reprints
  • Articles
    • OnlineFirst
    • Current Issue
    • Past Issues
    • Meeting Abstracts
    • Collections
      • COVID-19 & Cancer Resource Center
      • Focus on Radiation Oncology
      • Novel Combinations
      • Reviews
      • Editors' Picks
      • "Best of" Collection
  • First Disclosures
  • For Authors
    • Information for Authors
    • Author Services
    • Best of: Author Profiles
    • Submit
  • Alerts
    • Table of Contents
    • Editors' Picks
    • OnlineFirst
    • Citation
    • Author/Keyword
    • RSS Feeds
    • My Alert Summary & Preferences
  • News
    • Cancer Discovery News
  • COVID-19
  • Webinars
  • Search More

    Advanced Search

Article

Potent and selective inhibitors of Akt kinases slow the progress of tumors in vivo

Yan Luo, Alexander R. Shoemaker, Xuesong Liu, Keith W. Woods, Sheela A. Thomas, Ron de Jong, Edward K. Han, Tongmei Li, Vincent S. Stoll, Jessica A. Powlas, Anatol Oleksijew, Michael J. Mitten, Yan Shi, Ran Guan, Thomas P. McGonigal, Vered Klinghofer, Eric F. Johnson, Joel D. Leverson, Jennifer J. Bouska, Mulugeta Mamo, Richard A. Smith, Emily E. Gramling-Evans, Bradley A. Zinker, Amanda K. Mika, Phong T. Nguyen, Tilman Oltersdorf, Saul H. Rosenberg, Qun Li and Vincent L. Giranda
Yan Luo
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Alexander R. Shoemaker
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Xuesong Liu
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Keith W. Woods
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Sheela A. Thomas
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Ron de Jong
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Edward K. Han
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Tongmei Li
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Vincent S. Stoll
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Jessica A. Powlas
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Anatol Oleksijew
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Michael J. Mitten
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Yan Shi
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Ran Guan
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Thomas P. McGonigal
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Vered Klinghofer
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Eric F. Johnson
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Joel D. Leverson
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Jennifer J. Bouska
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Mulugeta Mamo
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Richard A. Smith
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Emily E. Gramling-Evans
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Bradley A. Zinker
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Amanda K. Mika
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Phong T. Nguyen
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Tilman Oltersdorf
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Saul H. Rosenberg
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Qun Li
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Vincent L. Giranda
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
DOI: 10.1158/1535-7163.MCT-05-0005 Published June 2005
  • Article
  • Figures & Data
  • Info & Metrics
  • PDF
Loading

Abstract

The Akt kinases are central nodes in signal transduction pathways that are important for cellular transformation and tumor progression. We report the development of a series of potent and selective indazole-pyridine based Akt inhibitors. These compounds, exemplified by A-443654 (Ki = 160 pmol/L versus Akt1), inhibit Akt-dependent signal transduction in cells and in vivo in a dose-responsive manner. In vivo, the Akt inhibitors slow the progression of tumors when used as monotherapy or in combination with paclitaxel or rapamycin. Tumor growth inhibition was observed during the dosing interval, and the tumors regrew when compound administration was ceased. The therapeutic window for these compounds is narrow. Efficacy is achieved at doses ∼2-fold lower than the maximally tolerated doses. Consistent with data from knockout animals, the Akt inhibitors induce an increase in insulin secretion. They also induce a reactive increase in Akt phosphorylation. Other toxicities observed, including malaise and weight loss, are consistent with abnormalities in glucose metabolism. These data show that direct Akt inhibition may be useful in cancer therapy, but significant metabolic toxicities are likely dose limiting.

Keywords:
  • Signal transduction
  • PKB
  • Akt
  • PTEN
  • mTOR
  • p70s6k
  • TSC1
  • TSC2
  • FOXO
  • FKHRL

Introduction

Akt activity is elevated in a large proportion of human malignancies, where it plays a central role in inducing a malignant phenotype by both promoting cell growth and decreasing apoptosis (1, 2). Akt1 is a serine/threonine protein kinase that was first discovered as the human homologue of the transforming gene in the AKT-8 oncogenic virus, which was isolated from a spontaneous thymoma in the AKR mouse (3, 4). Since the discovery of human Akt1 (also called protein kinase B), two additional mammalian Akt isoforms, Akt2 and Akt3, have been identified (5–8).

Akt is downstream of phosphatidylinositol 3-kinase (PI3K) and is a critical node in this signal transduction pathway. The activation of Akt by PI3K is antagonized by the tumor suppressor PTEN (9). Thus, the increased Akt activity that is observed in most human malignancies could be the result of (a) an increased Akt expression, (b) increased PI3K activity, or (c) decreased PTEN activity (10). Correlative evidence for all three of these mechanisms has been found in human tumors. Akts are overexpressed in a variety of human tumors (7, 11–13), and at the genomic level, AKT1 and AKT2 have been shown to be amplified in a number of cancer types (7). PI3K activity is increased by numerous growth factors, many of which are themselves targets for cancer therapy (e.g., KDR and HER2; refs. 14–16). PTEN mutations that result in increased Akt activity have likewise been described in a wide variety of malignancies (17–19). Alterations that increase Akt activity (e.g., PTEN loss, PI3K up-regulation, and increased Akt expression) rival alterations in the p53/p16 pathway as the most common changes found in malignant tumor cells (10, 20).

In addition to the correlative data, there is also considerable experimental evidence for the importance of PI3K, Akt, and PTEN in neoplasia. The constitutive expression of active Akts promotes tumorigenesis when these Akt-expressing clones are inoculated into nude mice (21–23). Mice heterozygous for Pten deletions, where Akt activity is dramatically increased, develop neoplasms in colon, testis, thyroid, prostate, endometrium, and liver. These animals also have an increased incidence of lymphoma and leukemia (24, 25). In humans, there are three closely related and inherited cancer syndromes caused by mutations in the PTEN locus: Cowden disease (26), Lhermitte-Duclos disease (26), and Bannayan-Zonana syndrome (27). Patients with these disorders have multiple benign tumors and greatly increased incidence of carcinomas.

In Drosophila, a germ line deletion of dAkt reverses the large cell phenotype in dPten−/− flies (28). More recently, deletion of Akt1 has been shown to reverse the aggressive growth phenotype of Pten−/− mouse embryonic stem cells (29). These data suggest the tumorigenic phenotype caused by loss of PTEN can be largely reversed by inhibition of Akt.

The prevalence of Akt activation in human tumors, coupled with the genetic experiments showing that PTEN deletions or active Akt can induce tumor formation, suggests that inhibition of Akt may be useful in the treatment of neoplastic diseases. Indeed, there have been attempts to modulate the activity of this pathway. Inhibition of PI3K directly has been reported to decrease the progression of tumors in rodents (30, 31). Likewise, using rapamycin or one of its analogues to inhibit the PI3K pathway downstream at mammalian target of rapamycin (mTOR) has been shown to reduce tumor growth in mouse models (several compounds are currently in human clinical trials; refs. 32, 33). There have also been reports of compounds that inhibit the activation of Akt [e.g., heat shock protein 90 inhibitors (34), pleckstrin homology domain inhibitors (35, 36), and others (37)]. Here we report on the discovery of potent compounds that directly inhibit the kinase activity of Akt. We also report the effects of these compounds on transformed cells in vitro as well as on tumor progression in vivo.

Materials and Methods

Crystallization and X-ray Analysis

Protein kinase A (PKA) was purified (38), concentrated to 20 mg/mL, and complexed with peptide inhibitor of PKA for 1 hour and complexed with A-443654 (39). Crystals were transferred to cryosolutions that contained well solution plus increasing amounts of glycerol, soaking for 1 minute in 5%, 15%, and 25% glycerol. Crystals were then frozen in a stream of 100°K nitrogen. Diffraction data were recorded using a MAR-165 CCD detector system on a Rigaku RU-2000 rotating anode X-ray generator (Danvers, MA) operating at 100 mA and 50 kV. Diffraction data were reduced using HKL2000 (HKL Research, Inc., Charlottesville, VA) and the protein model (accession number 1YDT) with the inhibitor (H89) and the phosphorylation sites omitted for initial phasing. Generation of initial electron density maps and structure refinement was achieved using CNX program package. Electron density maps were generated using the program QUANTA 97/2001 (Accelrys, San Diego, CA), and compound A-44654 was fit to the electron density. The structure was determined to a resolution of 2.7 Å and refined to Rwork = 24.41% and RFree = 30.18 %.

In vitro Kinase Assays

Recombinant CK2, PKCγ, and PKCδ (Calbiochem, San Diego, CA); PKA (Panvera, Madison, WI); cyclin-dependent kinase 2/CyclinA, GSK3β, MAPK-AP2, Src, and RSK2 (Upstate Biotechnology, Charlottesville, VA); extracellular signal–regulated kinase 2 (New England Biolabs, Beverly, MA), cKit (544-976; ProQinase, Freiburg, Germany) were commercially obtained. His-tagged Akt1 (S378A, S381A, T450D, S473D; 139-480), Chk1 (1-269), KDR (789-1354), Flt-1 (786-1338), and phosphatidylinositide-dependent kinase 1 (1-396), were expressed using the FastBac bacculovirus expression system (Life Technologies, Gaithersburg, MD) and purified using either nickel (his-tag) or glutathione S-transferase affinity chromatography. Peptides substrates had the general structure biotin-Ahx-peptide with the following sequences: Akt, EELSPFRGRSRSAPPNLWAAQR; PKA, LRRASLG; PKCγ and PKCδ, ERMRPRKRQGSVRRRV; CK2, RRADDSDDDDD; cyclin-dependent kinase 2, LPPCSPPKQGKKENGPPHSHTLKGRRAAFDNQL; GSK3β, YRRAAVPPSPSLSRHSSPHQS(p)EDEEE; MAPK-AP2, KKLNRTLSVA; RSK2, KKKNRTLSVA; extracellular signal–regulated kinase 2, KRELVEPLTPSGEAPNQALLR; Chk1, AKVSRSGLYRSPSMPENLNRPR; phosphatidylinositide-dependent kinase 1, [protein fragment, 39 aa]; KDR, Flt-1, and cKit, AEEEYFFLFA-amide. For Src assays, the biotinylated substrate PTK-2 (Promega, Madison, WI) was used. Inhibition of kinase activity was assessed using a radioactive FlashPlate-based assay platform as previously described (40).

Alamar Blue Cell Viability Assay

The cells on 96-well plates were gently washed with 200 μL of PBS. Alamar Blue reagent (Biosource International, Carmarillo, CA) was diluted 1:10 in normal growth media. The diluted Alamar Blue reagent (100 μL) was added to each well on the 96-well plates and incubated until the reaction was complete as per manufacturer's instructions. Analysis was done using an fmax Fluorescence Microplate Reader (Molecular Devices, Sunnyvalle, CA), set at the excitation wavelength of 544 nm and emission wavelength of 595 nm. Data were analyzed using SOFTmax PRO software provided by the manufacturer.

Protein Extraction and Western Blot Analysis

Cells were treated with 0 to 30 μmol/L of Akt inhibitors for 2 hours. All drug samples were adjusted to contain equal volumes of the vehicle (DMSO). Cells were harvested, sonicated for 5 minutes in ice-cold insect cell lysis buffer [BD PharMingen, San Diego, CA; 10 mmol/L Tris-HCl (pH 7.5), 130 mmol/l NaCl, 1% Triton X-100, 10 mmol/L NaF, 10 mmol/L NaPi, 10 mmol/L NaPPi and 1 μg/mL microcyctin LR plus the protease inhibitors aprotinin (10 μg/mL), leupeptin (10 μg/mL), and phenylmethylsulfonyl fluoride (1 mmol/L)], and centrifuged at 15,300 rpm for 10 minutes. The concentrations of the total lysate protein were determined using a standard Bradford assay (Bio-Rad, San Diego, CA).

MiaPaCa-2 pancreatic tumor–bearing mice were treated with control vehicle or A-443654 at 7.5 or 75 mpk for 2 hours. Tumors were isolated and immediately frozen in liquid nitrogen. Frozen tumor tissues were sliced in thin sections and resuspended in 500 μL of lysis buffer. This suspension was homogenized with a Polytron PT 1200C (Kinematica AG, Luzern, Switzerland) for 2 minutes. The homogenized tissues were centrifuged at 15,300 rpm for 10 minutes, supernatants were collected, and the protein concentrations were determined with the Bradford method.

For Western blot analysis, 40 μg of protein from the total cell lysate were electrophoresed by SDS-PAGE. The proteins were then electrotransfered onto immobilon-P membranes (Millipore, Bedford, MA), using transfer buffer (25 mmol/L Tris, 190 mmol/L glycine, and 10% methanol). Membranes were treated with blocking buffer (50 mmol/L Tris, 200 mmol/L NaCl, 0.2% Tween 20, 5% nonfat dry milk) for 1 hour at room temperature and incubated with 1:1,000 dilution of antibodies (phospho-GSK3 α/β Ser21/9, phospho-TSC2 Thr1462, phospho-FOXO1A/3A Thr24/32, phospho-ribosomal protein S6 Ser235/236 phospho-Akt1 Ser473, and phospho-mTOR Ser2448; all from Cell Signaling Technology, Beverly, MA) for 16 hours at 4°C. After washing with blocking buffer without 5% nonfat dry milk (washing buffer) for 30 minutes, the membranes were incubated with horseradish peroxidase–linked anti-rabbit donkey serum (1:1,000; Amersham, Arlington Heights, IL) for 1 hour. Membranes were then washed with washing buffer and immune detection was done using the enhanced chemiluminescence Western blotting detection system (Amersham). Quantitation of Western blots was done using a phospho-imager (Amersham Biosciences, Piscataway, NJ).

FL5.12 Akt1-, Akt2-, or Akt3- Overexpressing Cell Lines

Stable transfectants of FL5.12 cells expressing full-length human Akt1, Akt2, or Akt3 were generated by electroporation with a pCIneo plasmid (Promega) containing Akt cDNAs with an NH2-terminal HA-tag (41). Single clones were isolated by limiting dilution and selection for G418 resistance (Invitrogen, Carlsbad, CA). Expression was confirmed by immunoblotting with Akt isoform-specific antibodies. FL5.12/Akt cell lines were maintained in RPMI 1640 supplemented with 10% fetal bovine serum, 10% WEHI-3B conditioned medium as a source of IL-3, nonessential amino acids, 1 mmol/L sodium pyruvate, 2 mmol/L glutamine, 50 μmol/L β-mercaptoethanol, 50 μg/mL G418, and 2.5 mmol/L HEPES (pH 7.5) at 37°C in a humidified atmosphere containing 5% CO2.

FOXO3A Translocation Assay

The pFOXO3A-hrGFP construct was engineered by inserting a FOXO3A fragment encoding NH2-terminal amino acids 1 to 400 into plasmid phrGFP (Stratagene, La Jolla, CA) using standard PCR and DNA recombinant techniques. This sequence includes the nuclear import and export signals and Akt phoshorylation sites (42). HeLa cells were plated into 6-well plates at a density of 0.3 × 106 cells per well and incubated at 37°C at 5% CO2 over night. Cells were transiently transfected with pFOXO3A-hrGFP plasmid using Effectene (Qiagen, Valencia, CA). At 40 hours post-transfection, cells were treated with compounds added to culture medium lacking phenol red. Equal amounts of DMSO were added to cells to a final concentration of 0.5%. After 6 hours, images of fluorescent live cells were captured by microscopy.

Tumor Efficacy Studies

Animal studies were conducted following the guidelines of the internal Institutional Animal Care and Use Committee. Immunocompromised male scid mice (C.B-17-Prkdcscid) were obtained from Charles River Laboratories (Wilmington, MA) at 6 to 8 weeks of age. MiaPaCa-2 and PC-3 cells were obtained from the American Type Culture Collection (Manassas, VA). The 3T3-Akt1 cell line was developed and characterized in our laboratory (23). The 1 × 106 3T3-Akt1 or 2 × 106 MiaPaCa-2 and PC-3 cells in 50% Matrigel (BD Biosciences, Bedford, MA) were inoculated s.c. into the flank. For early treatment studies, mice were randomly assigned to treatment groups and therapy was initiated the day after inoculation. Ten animals were assigned to each group, including controls. For established tumor studies, tumors were allowed to reach a designated size and mice were assigned to treatment groups of equal tumor size (n = 10 mice per group). Tumor size was evaluated by twice weekly measurements with digital calipers. Tumor volume was estimated using the formula: V = L × W2 / 2. A-443654 was given s.c. in a vehicle of 0.2% HPMC. A-674563 was given orally in a vehicle of 5% dextrose. Gemcitabine and paclitaxel were obtained from Eli Lilly and Company (Indianapolis, IN) and Bristol-Myers Squibb Co. (Princeton, NJ), respectively, and given according to the manufacturers' guidelines.

For the determination of plasma drug concentrations, proteins were precipitated with two volumes of acidified methanol. Tissue samples were taken from the same animals and homogenized with 2 volumes of saline, then precipitated with 2 volumes of acetonitrile. Precipitated proteins were removed by centrifugation and supernatants were stored at −20°C until analysis by UV-liquid chromatography or liquid chromatography-mass spectrometry. Plasma and tissue extracts were injected directly on a C18 reversed phase column (YMC-AQ 5 μ; Waters Co., Milford, MA) and eluted using combinations of acetonitrile, methanol and 8 mmol/L triethylamine acetate buffer (pH 4) with UV detection (Shimadzu 10A/VP, Shimadzu Scientific, Columbia, MD) or with acetonitrile and 0.1% acetic acid in water for mass spectrometer analysis (LCQ Duo, Thermoquest, San Jose, CA). Pharmacokinetic variables were calculated using WinNonlin software.(Pharsight Co., Mountain View, CA).

Immunohistochemistry

3T3-Akt1 and MiaPaCa-2 tumors were fixed for 48 hours in Streck Tissue Fixative (Streck Laboratories, Omaha, NE), processed, and embedded in paraffin; 5-μm tissue sections were blocked with streptavidin/biotin complex followed by 0.3% bovine serum albumin before incubation with primary antibody (caspase-3: rabbit anti-active Caspase-3 at 1:400, BD PharMingen; phospho-Akt: rabbit anti-phospho-Akt at 1:200, Cell Signaling Technology) for 1 hour at room temperature. Secondary antibody was used at 1:250 to 300 followed by streptavidin-biotin horseradish peroxidase and 3,3′-diaminobenzidine color development.

Results

Discovery of Indazole-Pyridine Series of Akt Inhibitors

The initial lead in this series was obtained from a high-throughput screen (Fig. 1A, compound 1). This compound weakly inhibited Akt (Ki = 5 μmol/L). The potency was improved by addition of an indole ring to the aliphatic side chain (Fig. 1A, compound 2), and still further improved by constraining rotatable bonds in the linker between the central and distal pyridine rings (Fig. 1A, compound 3). Addition of a second hydrogen bonding interaction to the hinge-binding region resulted in A-443654, that exhibited a Ki of 160 pmol/L, a 30,000-fold improvement in potency versus the initial lead molecule. Finally, a compound with oral activity was achieved by replacing the indole with a phenyl moiety (Fig. 1A, A-674563).

Figure 1.
  • Download figure
  • Open in new tab
  • Download powerpoint
Figure 1.

A, a schematic representation of the discovery of the indazole-pyridine series of Akt inhibitors. B, the X-ray structure of A-443654 bound to the ATP binding site of PKA. The structures of both Akt and PKA contain very similar ATP binding sites, with only four amino acid differences within the inhibitor binding sites and minimal differences between the protein backbones. Dotted lines, hydrogen bonds between A-443654 and PKA. C, the line drawing also illustrates the A-443654 mode of binding, with the indazole binding to the hinge region, the pyridine N binding to a conserved lysine, and the indole ring binding under the glycine-rich loop.

The series of indazole-pyridine compounds bind to the ATP site of Akt. These compounds are potent, ATP competitive, and reversible inhibitors of the Akt catalyzed phosphorylation activity. The three-dimensional structures of these compounds complexed with a closely related protein kinase, PKA (Fig. 1B-C), were determined by X-ray crystallography. Three hydrogen bond sets are critical to maintain potency. The first is a canonical hydrogen bond to the hinge region backbone found with most ATP-competitive kinase inhibitors. The second is formed between the inhibitor's central pyridine ring and a conserved lysine (Lys72 in PKA and Lys181 in Akt1). The third set of important hydrogen bonding interactions form between the primary amino group of the inhibitor's aliphatic side chain and the PKA residues Asn171 and Asp184 (Asn279 and Asp292 in Akt1). This position is normally occupied by a divalent cation of Mg2+ ATP.

In vitro Activity

A-443654 is a pan Akt inhibitor and has equal potency against Akt1, Akt2, or Akt3 within cells (Fig. 2). A-443654 is, however, very selective for Akt versus other kinases (Table 1). It is the least selective towards several closely related kinases in the AGC family, including PKA and protein kinase C (PKC). Even so, A-443654 is 40-fold selective for Akt over PKA. A-674563 is somewhat less selective, particularly against the cyclin-dependent kinases in the CMGC family. However, in spite of the selectivity differences between these two classes of Akt inhibitors, their behavior is similar in cells and in vivo (see below).

Figure 2.
  • Download figure
  • Open in new tab
  • Download powerpoint
Figure 2.

A-443654 inhibits Akt1, Akt2, or Akt3 equally within cells. Murine FL5.12 cells were stably transfected with constitutively active myristoylated human Akt1 (•), Akt2 (▴), or Akt3 (▪). There is no appreciable phosphorylation of GSK3 in the parental cell lines, whereas there are high levels of phospho-GSK3 (P-GSK3) observed in all three Akt overexpressing lines. A-443654 reduces the P-GSK3 in a dose-responsive manner in all three cell lines. The broad-spectrum kinase inhibitor staurosporine was added at 1 μmol/L as a positive control. The P-GSK3 was quantitated and normalized to the total GSK3. Plot of the resulting inhibition for each overexpressing cell line (right).

View this table:
  • View inline
  • View popup
Table 1.

Selectivity of Akt inhibitors for selected kinases

The phosphorylation of Akt downstream targets such as GSK3α/β, FOXO3, TSC2, and mTOR were measured as an indication of Akt activity within cells. The Akt inhibitors reduced the phosphorylation of all of these proteins in a dose-dependent fashion (Fig. 3A). As expected, we also observed that FOXO3 translocates into the nucleus upon the reversal of its phosphorylation induced by Akt inhibition (Fig. 3B). Phosphorylation of signaling molecules further downstream in the Akt pathway, such as the S6 protein, was also reduced by the Akt inhibitors.

Figure 3.
  • Download figure
  • Open in new tab
  • Download powerpoint
Figure 3.

Akt inhibitors affect the phosphorylation and localization of cellular Akt substrates. A, MiaPaCa-2 cells were treated for 2 h with various concentrations of Akt inhibitors A-443654 and A-674563. Western blot analyses were done to assess the phosphorylation of Akt, GSK3 α/β, TSC2, mTOR, and ribosomal protein S6. B, HeLa cells transiently transfected with pFOXO3A-hrGFP were treated with A-443654 for 6 h. Images of live cells taken by fluorescence microscopy. Transcription factor FOXO3A is retained in the cytoplasm when phosphorylated by Akt. DMSO vehicle and 20 mmol/L LY 294002 (an inhibitor of PI3K) were used as negative and positive controls, respectively. C, MiaPaCa-2 cells were treated with A-443654 or A-674563 for 48 h. Alamar blue cell viability assays were done to measure the cell growth inhibition. Points, average of three determinations; bars, SD.

Together with the decrease in phosphorylation of Akt targets, we observed a concomitant increase in the Thr308 and Ser473 phosphorylation of Akt. This increase has been observed with all of the Akt inhibitors tested and seems a sensitive marker of Akt inhibition. However, in spite of the increased Akt activation, the ability of Akt to phosphorylate its downstream targets was markedly decreased in the presence of the inhibitors (Fig. 3A). The addition of 20 μmol/L of the PI3K inhibitor Ly294002 together with A-443654 eliminates the Akt inhibitor induced increase in Akt phosphorylation (data not shown), suggesting increased phosphatidylinositol 3,4,5-triphosphate is required for the A-443654 induced increase in Akt phosphorylation.

To investigate the effects of Akt inhibition on cell proliferation, we did an 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide assay. The Akt inhibitors slowed proliferation of tumor cells with an EC50 of 0.1 μmol/L for A-443654 and 0.4 μmol/L for A-674563 (Fig. 3C).

In vivo Antitumor Activity

We tested both A-443654 and A-674563 for their ability to inhibit tumor growth in vivo (Fig. 4). A-443654 is more potent and more selective than A-674563 but is not available orally. Furthermore, the length of time A-443654 can be given is limited to 14 days due to severe injection site irritation. Nevertheless, in spite of the differences between these compounds, both compounds behave similarly in vivo.

Figure 4.
  • Download figure
  • Open in new tab
  • Download powerpoint
Figure 4.

Akt inhibitors slow tumor growth in vivo. A, A-443654 inhibits tumor growth in the 3T3-Akt1 flank tumor model. The scid mice bearing established 3T3-Akt1 tumors were treated s.c. bid for 14 d with vehicle (▵), A-443654 at 7.5mg/kg/d (▪), or the inactive analogue, 2-methyl A-443654 at 7.5 mg/kg/d (□). Therapy was initiated 21 d after tumor inoculation when the mean tumor volume of each group was ∼245 mm3. A-443654 was statistically different from vehicle from day 26 onward (P < 0.02). B, A-443654 inhibits tumor growth in the MiaPaCa-2 xenograft tumor model. scid mice were inoculated with cells on day 0 and therapy was begun on day 1. A-443654 at 7.5 mg/kg/d (▴) or vehicle (▵) was given s.c., bid for 14 d. Gemcitabine at 120 mg/kg/d (▪) or vehicle (□) was given i.p., qd on days 3, 6, 9, and 12. A-443654 and gemcitabine both significantly inhibited tumor growth (P < 0.03). C, A-674563/paclitaxel combination therapy in the PC-3 prostate cancer xenograft model. scid mice bearing established PC-3 tumors were treated with A-674563 (▵) p.o., bid at 40 mg/kg/d for 21 d; paclitaxel (▴) i.p., qd at 15 mg/kg/d on days 20, 24, and 28; the combination (▪); or the combination vehicle (□). Therapy was initiated 20 d after tumor inoculation when the mean tumor volume for each group was ∼270 mm3. Although A-674563 showed no significant monotherapy activity, the efficacy of the combination therapy was significantly improved compared to paclitaxel monotherapy (P < 0.002). D, A-443654 and rapamycin efficacy in the MiaPaCa-2 pancreatic cancer xenograft model. scid mice bearing established tumors were treated with A-443654 (▪) s.c., tid at 50 mg/kg/d on days 16, 20, and 24; rapamycin (□) i.p., qd at 20 mg/kg/d for 15 d; the combination of rapamycin plus A-443654 (⧫); s.c. vehicle (▴); or combination vehicle (▵). Therapy was initiated 16 d after tumor inoculation when the mean tumor volume for each group was ∼255 mm3. Each monotherapy showed significant activity throughout the study (P < 0.01) and the combination was statistically better than either monotherapy from day 23 onward (P < 0.01).

The effect of the inhibitors was examined in several Akt-dependent models. We tested a genetically engineered model, where 3T3 murine fibroblasts stably express a constitutively active form of Akt1. In contrast to the parental 3T3 cell line, the 3T3-Akt1 cells have a dramatically increased ability to form colonies in soft agar as well as tumors in immunocompromised mice, suggesting the active Akt1 is responsible for the transformed phenotype (23). In this model, A-443654 inhibited the growth of the tumors (Fig. 4A); whereas the 2-methyl analogue of A-443654, which is 5,000-fold less active versus Akt1, showed no effect in this model. We also tested the compounds in a MiaPaCa-2 human pancreatic cell xenograft model, where we compared the efficacy with gemcitabine. MiaPaCa-2 is a human pancreatic carcinoma line with constitutively active Akt (43). Here again, the Akt inhibitor significantly slowed the growth of the tumors (Fig. 4B). A-443654 also showed antitumor activity in two rat orthotopic syngeneic models of tumor growth, a MatLyLu prostate carcinoma and a 9L glioblastoma (data not shown).

In all models tested, the tumors rapidly regrew after compound administration was stopped. The cytostatic behavior of the inhibitors suggests that continuous dosing may lead to increased efficacy. The number of consecutive days the orally available compounds could be dosed, unlike the parenteral compounds, was not limited by injection site toxicity. Nevertheless, the oral compounds could only be given for 15 to 25 days, after which time the animals became moribund. In all cases, the compounds were given at their respective maximally tolerated doses.

Activation of the Akt pathway is thought to inhibit apoptosis induced by a variety of cytotoxic agents and has been reported to be an effective survival mechanism in many tumor cells (44–47). Therefore, we attempted to combine the Akt inhibitors with the antimitotic agent paclitaxel in a PC-3 xenograft model (48, 49). PC-3 is a PTEN-deficient human prostate carcinoma cell line, where resistance to chemotherapeutic agents is at least partially dependent on Akt activity (50). When given in combination, A-674563 increased the efficacy of paclitaxel in a PC-3 xenograft model (Fig. 4C).

We tested the pharmacokinetics and pharmacodynamics to insure that we were inhibiting Akt in vivo (Fig. 5). When the inhibitors were given at their maximally tolerated doses on a twice daily (bid) schedule, their concentration in plasma remained above the cellular EC50 for ∼5 hours (Fig. 5A). Concentrations in tumors were significantly higher than those in plasma, and drug concentrations in tumor remained above the cellular EC50 for the entire 12-hour dosing interval (Fig. 5B). In the tumors, as we have seen in the cellular assays, the inhibition of GSK3 and S6 phosphorylation are inhibited in a dose responsive manner by the Akt inhibitors (Fig. 5C). As also seen in the cellular studies, the increase in Akt phosphorylation seems the most sensitive marker for Akt inhibition. This suggests that the cells, in vivo, are also sensitive to Akt inhibition, and attempt to compensate for the loss of the activity.

Figure 5.
  • Download figure
  • Open in new tab
  • Download powerpoint
Figure 5.

The effects of Akt inhibitors after in vivo administration. Plasma (A) and tumor (B) concentrations of A-443654 are plotted versus the time after a final dose of A-443654 was given. Animals were treated at (•) 3.8, (▪) 7.5, or (▴) 15 mg/kg bid for 3 d before measurement. C, 2 h after A-443654 administration, the phosphorylation of Akt (solid columns), S6 Protein (open columns), and GSK3 (cross-hatched columns) were measured via Western blotting (bottom). Akt phosphorylation increases in response to the Akt inhibitor. In spite of this increase in P-Akt, phosphorylation of targets downstream from Akt is inhibited in a dose-responsive manner. D, A-443654 induces apoptosis in 3T3-Akt1 flank tumors. The scid mice bearing established 3T3-Akt1 tumors were given a single s.c. dose of A-443654 at 50 mg/kg or vehicle. Tumors were removed 8 h after treatment and apoptosis was examined by immunohistochemical staining with an antibody specific for the activated form of caspase-3. E, A-443654 treatment leads to increased levels of phosphorylated Akt1 in MiaPaCa-2 tumors. The scid mice bearing established MiaPaCa-2 flank tumors were given a single s.c. 30 mg/kg dose of A-443654. One hour after treatment, tumors were removed and the level of phospho-Akt was examined by immunohistochemical staining. F, A-674563 and A-443654 increase plasma insulin in an oral glucose tolerance test. Fasted animals administered vehicle (▪), 20 mg/kg A-674563 (•), 100 mg/kg A-674563 (○), or 20 mg/kg A-443654 (▴) 30 min before the 1 g/kg glucose challenge (time 0). Insulin levels were elevated in all A-674563- and A-443654-treated animals. Similar increases in insulin responses were seen in the sham-challenged (no glucose challenge) animals after treating with Akt inhibitors (data not shown).

We also examined caspase-3 activation (a measure of apoptosis) and Akt phosphorylation by immunohistochemistry. As expected, at 8 hours after a single dose of A-443654, we observed an increase in apoptotic cells (Fig. 5D), suggesting that at least part of the antitumor activity of the Akt inhibitors is due to apoptosis induction. Normal liver and colon tissues showed no increase in apoptosis following treatment (data not shown). Corroborating the Western blot analysis, we also observed that the phosphorylation of Akt increased when inhibitors are given (Fig. 5E).

As seen in Fig. 5C, doses near the MTD do not maximally inhibit Akt within tumors. Furthermore, drug washout studies in cells suggested that compounds were more effective at inducing apoptosis when maintained above their cellular EC50 for at least 12 hours (data not shown). As stated above, the plasma concentrations of A-443654 fall below this EC50 after about 5 hours. In an attempt to increase the efficacy of A-443654 by intensifying the dosing regime, the compound was given thrice in a single day, 3 hours apart, for a total of 50 mg/kg/d. The animals could not tolerate 50 mg/kg/d every day; thus, compound was given every fourth day. This regime maintains the plasma concentrations of A-443654 above its cellular EC50 for >12 hours. This thrice daily (tid)/q4d schedule proved to be more efficacious than the bid/daily schedule (Fig. 4D). Note that for the tid schedule, dosing was started on established tumors whereas for the bid schedule dosing was started immediately after tumor cell inoculation. Similar to what was observed with the bid/daily schedule, when treated on the tid/q4d schedule, the tumors regrew soon after dosing was stopped.

Akt inhibition was compared with inhibition further downstream in the PI3K pathway at mTOR, using rapamycin (Fig. 4D). When dosed, both the Akt inhibitors and rapamycin are efficacious in the MiaPaCa-2 model. However, rapamycin is significantly less toxic and has a much larger therapeutic window than the Akt inhibitors. Furthermore, rapamycin therapy can be maintained longer, leading to more durable responses. The function of mTOR in tumor progression does not seem completely epistatic to that of Akt, as the efficacy observed for the combination of the Akt and mTOR inhibitors was better than that observed for either agent alone.

Metabolic Consequences of Akt Inhibition

Akt is downstream of the insulin receptor and transduces the insulin response in vivo. We therefore measured blood sugar and insulin responses related to the inhibition of Akt. We examined random blood sugars during multiple tumor studies and have never observed any differences between the treated and control groups. We also measured both blood sugar and plasma insulin levels in glucose challenge tests. Blood sugars were not changed upon administration of Akt inhibitors, even when supertherapeutic doses were given (data not shown). We did, however, observe significant increases in plasma insulin following administration of a single dose of Akt inhibitors at therapeutic doses (Fig. 5F). This data is consistent with a homeostatic response, where the animals increase insulin secretion to maintain blood glucose concentrations. This is also what has been observed in Akt2 knockout animals (51, 52). When young, these animals have normal blood sugars but increased plasma insulin. Only when older, after islet cell failure, do the animals lose their ability to maintain normal blood glucose concentrations.

While determining the maximum tolerated dose, we found that the Akt inhibitors induce a dose- and time-dependent weight loss in treated animals. This weight loss is typically >10% of total body mass when compounds are given at thrice their maximum tolerated dose (data not shown). Whereas weight loss is a general toxicity, it is consistent with the expectation that the compounds may interfere with the utilization of glucose by interfering with the insulin pathway.

Discussion

We have shown that inhibitors of Akt, when dosed to levels that inhibit Akt in vivo, can slow the tumor growth in laboratory models of cancer. Several compounds have been tested and have shown efficacy in a number of tumor models. In all of these models, the dosing period is limited due to toxicity of the therapy. In addition, in all models, the tumors regrew rapidly when dosing is stopped. The Akt inhibitors show efficacy in the same models where activity is observed with rapamycin. However, the Akt inhibitors have a narrower therapeutic window than does rapamycin.

The dose-limiting toxicities for the oral compounds, malaise and weight loss, are consistent with a mechanism-based toxicity, where the inhibitors interfere with the metabolism of glucose (the limiting toxicity for parenteral compounds is an injection site irritation). However, weight loss is a general toxicity seen with many anticancer agents that do not inhibit Akt. Also consistent with mechanism-based toxicity is the observation that compounds with substantially different selectivity profiles, but similar Akt inhibitory activity, elicit the same types of toxicity. The increase in plasma insulin attendant with Akt inhibition also suggests metabolic toxicities may be dose limiting. Further studies with more widely divergent Akt inhibitors will be required to ascertain if Akt inhibition as cancer therapy will be limited by mechanism-based metabolic toxicities.

Whereas the efficacy observed in the tumor models is promising, it is clear that inhibition of Akt as a therapy for cancer would benefit from a widening of the therapeutic window. A number of active investigations are under way to further improve the therapeutic window. The inhibitors described here are pan-Akt inhibitors, and in cells have equal potency inhibiting Akt1, Akt2, or Akt3 within cells. Akt2 loss seems to predominate in toxicity related to insulin signaling (51, 52), whereas Akt1 has been reported to be more important in cancer cell survival. Thus, generation of inhibitors more selective for Akt1 over Akt2 might improve therapeutic window. Furthermore, it is clear from the paclitaxel study that Akt inhibitors may collaborate with chemotherapeutics that induce apoptosis. Akt has recently been shown to collaborate with Bcl2/BclXL in several cell lines to inhibit apoptosis in cancer cells (50). Thus, using these Akt inhibitors with other agents may produce the desired improvement in therapeutic window by improving efficacy without increasing toxicity.

Finally, the Akt inhibitors, along with rapamycin, illustrate that different nodes in the PI3K signal transduction pathway can be inhibited to slow tumor progression. The efficacy of the Akt and mTOR inhibitors suggests that, as monotherapy, other inhibitors of the PI3K pathway will also be efficacious. However, the differences in toxicity suggest that inhibiting at different nodes in the PI3K pathway might yield very different therapeutic windows. There are a number of potential targets in this pathway, including PI3K, phosphatidylinositide-dependent kinase 1, ILK, Akt1, Akt2, Akt3, mTOR, p70S6K, and 4E-BP1, all of which are under investigation for utility in human cancer therapy. The results of these investigations will ultimately determine where to target the PI3K pathway to provide the best efficacy and therapeutic window for the treatment of cancer.

Acknowledgments

We thank Lisa Li and Jennifer Hensel for their technical assistance with many of the cellular assays and Stephen Fesik for his assistance in editing this article.

Footnotes

  • The costs of publication of this article were defrayed in part by the payment of page charges. This article must therefore be hereby marked advertisement in accordance with 18 U.S.C. Section 1734 solely to indicate this fact.

  • Grant support: R. de Jong is currently at the Syrrx, Inc., 10410 Science Center Drive, San Diego, CA 92121.

    • Accepted April 11, 2005.
    • Received January 6, 2005.
    • Revision received March 16, 2005.
  • American Association for Cancer Research

References

  1. ↵
    Vivanco I, Sawyers CL. The phosphatidylinositol 3-kinase AKT pathway in human cancer. Nat Rev Cancer 2002;2:489–501.
    OpenUrlCrossRefPubMed
  2. ↵
    Luo J, Manning BD, Cantley LC. Targeting the PI3K-Akt pathway in human cancer: rationale and promise. Cancer Cell 2003;4:257–62.
    OpenUrlCrossRefPubMed
  3. ↵
    Jones PF, Jakubowicz T, Pitossi FJ, Maurer F, Hemmings BA. Molecular cloning and identification of a serine/threonine protein kinase of the second-messenger subfamily. Proc Natl Acad Sci U S A 1991;88:4171–5.
    OpenUrlAbstract/FREE Full Text
  4. ↵
    Bellacosa A, Testa JR, Staal SP, Tsichlis PN. A retroviral oncogene, akt, encoding a serine-threonine kinase containing an SH2-like region. Science 1991;254:274–7.
    OpenUrlAbstract/FREE Full Text
  5. ↵
    Nakatani K, Sakaue H, Thompson DA, Weigel RJ, Roth RA. Identification of a human Akt3 (protein kinase B γ) which contains the regulatory serine phosphorylation site. Biochem Biophys Res Commun 1999;257:906–10.
    OpenUrlCrossRefPubMed
  6. Masure S, Haefner B, Wesselink JJ, et al. Molecular cloning, expression and characterization of the human serine/threonine kinase Akt-3. Eur J Biochem 1999;265:353–60.
    OpenUrlPubMed
  7. ↵
    Staal SP. Molecular cloning of the akt oncogene and its human homologues AKT1 and AKT2: amplification of AKT1 in a primary human gastric adenocarcinoma. Proc Natl Acad Sci U S A 1987;84:5034–7.
    OpenUrlAbstract/FREE Full Text
  8. ↵
    Cheng JQ, Godwin AK, Bellacosa A, et al. AKT2, a putative oncogene encoding a member of a subfamily of protein-serine/threonine kinases, is amplified in human ovarian carcinomas. Proc Natl Acad Sci U S A 1992;89:9267–71.
    OpenUrlAbstract/FREE Full Text
  9. ↵
    Maehama T, Dixon JE. The tumor suppressor, PTEN/MMAC1, dephosphorylates the lipid second messenger, phosphatidylinositol 3,4,5-trisphosphate. J Biol Chem 1998;273:13375–8.
    OpenUrlAbstract/FREE Full Text
  10. ↵
    Di Cristofano A, Pandolfi PP. The multiple roles of PTEN in tumor suppression. Cell 2000;100:387–90.
    OpenUrlCrossRefPubMed
  11. ↵
    Nakatani K, Thompson DA, Barthel A, et al. Up-regulation of Akt3 in estrogen receptor-deficient breast cancers and androgen-independent prostate cancer lines. J Biol Chem 1999;274:21528–32.
    OpenUrlAbstract/FREE Full Text
  12. Sun M, Wang G, Paciga JE, et al. AKT1/PKB α kinase is frequently elevated in human cancers and its constitutive activation is required for oncogenic transformation in NIH3T3 cells. Am J Pathol 2001;159:431–7.
    OpenUrlCrossRefPubMed
  13. ↵
    Yuan ZQ, Sun M, Feldman RI, et al. Frequent activation of AKT2 and induction of apoptosis by inhibition of phosphoinositide-3-OH kinase/Akt pathway in human ovarian cancer. Oncogene 2000;19:2324–30.
    OpenUrlCrossRefPubMed
  14. ↵
    Gerber HP, McMurtrey A, Kowalski J, et al. Vascular endothelial growth factor regulates endothelial cell survival through the phosphatidylinositol 3′-kinase/Akt signal transduction pathway. Requirement for Flk-1/KDR activation. J Biol Chem 1998;273:30336–43.
    OpenUrlAbstract/FREE Full Text
  15. Yakes FM, Chinratanalab W, Ritter CA, King W, Seelig S, Arteaga CL. Herceptin-induced inhibition of phosphatidylinositol-3 kinase and Akt is required for antibody-mediated effects on p27, cyclin D1, and antitumor action. Cancer Res 2002;62:4132–41.
    OpenUrlAbstract/FREE Full Text
  16. ↵
    Datta K, Bellacosa A, Chan TO, Tsichlis PN. Akt is a direct target of the phosphatidylinositol 3-kinase. Activation by growth factors, v-src and v-Ha-ras, in Sf9 and mammalian cells. J Biol Chem 1996;271:30835–9.
    OpenUrlAbstract/FREE Full Text
  17. ↵
    Steck PA, Pershouse MA, Jasser SA, et al. Identification of a candidate tumour suppressor gene, MMAC1, at chromosome 10q23.3 that is mutated in multiple advanced cancers. Nat Genet 1997;15:356–62.
    OpenUrlCrossRefPubMed
  18. Li J, Yen C, Liaw D, et al. PTEN, a putative protein tyrosine phosphatase gene mutated in human brain, breast, and prostate cancer. Science 1997;275:1943–7.
    OpenUrlAbstract/FREE Full Text
  19. ↵
    Cairns P, Okami K, Halachmi S, et al. Frequent inactivation of PTEN/MMAC1 in primary prostate cancer. Cancer Res 1997;57:4997–5000.
    OpenUrlAbstract/FREE Full Text
  20. ↵
    Cantley LC, Neel BG. New insights into tumor suppression: PTEN suppresses tumor formation by restraining the phosphoinositide 3-kinase/AKT pathway. Proc Natl Acad Sci U S A 1999;96:4240–5.
    OpenUrlAbstract/FREE Full Text
  21. ↵
    Cheng JQ, Altomare DA, Klein MA, et al. Transforming activity and mitosis-related expression of the AKT2 oncogene: evidence suggesting a link between cell cycle regulation and oncogenesis. Oncogene 1997;14:2793–801.
    OpenUrlCrossRefPubMed
  22. Mende I, Malstrom S, Tsichlis PN, Vogt PK, Aoki M. Oncogenic transformation induced by membrane-targeted Akt2 and Akt3. Oncogene 2001;20:4419–23.
    OpenUrlCrossRefPubMed
  23. ↵
    Liu X, Powlas J, Shi Y, et al. Rapamycin inhibits Akt-mediated oncogenic transformation and tumor growth. Anticancer Res 2004;24:3899–905.
    OpenUrlAbstract/FREE Full Text
  24. ↵
    Di Cristofano A, Pesce B, Cordon Cardo C, Pandolfi PP. Pten is essential for embryonic development and tumour suppression. Nat Genet 1998;19:348–55.
    OpenUrlCrossRefPubMed
  25. ↵
    Suzuki A, de la Pompa JL, Stambolic V, et al. High cancer susceptibility and embryonic lethality associated with mutation of the PTEN tumor suppressor gene in mice. Curr Biol 1998;8:1169–78.
    OpenUrlCrossRefPubMed
  26. ↵
    Liaw D, Marsh DJ, Li J, et al. Germline mutations of the PTEN gene in Cowden disease, an inherited breast and thyroid cancer syndrome. Nat Genet 1997;16:64–7.
    OpenUrlCrossRefPubMed
  27. ↵
    Marsh DJ, Dahia PL, Zheng Z, et al. Germline mutations in PTEN are present in Bannayan-Zonana syndrome [letter]. Nat Genet 1997;16:333–4.
    OpenUrlCrossRefPubMed
  28. ↵
    Gao X, Neufeld TP, Pan D. Drosophila PTEN regulates cell growth and proliferation through PI3K-dependent and -independent pathways. Dev Biol 2000;221:404–18.
    OpenUrlCrossRefPubMed
  29. ↵
    Stiles B, Gilman V, Khanzenzon N, et al. Essential role of AKT-1/protein kinase B α in PTEN-controlled tumorigenesis. Mol Cell Biol 2002;22:3842–51.
    OpenUrlAbstract/FREE Full Text
  30. ↵
    Bondar VM, Sweeney-Gotsch B, Andreeff M, Mills GB, McConkey DJ. Inhibition of the phosphatidylinositol 3′-kinase-AKT pathway induces apoptosis in pancreatic carcinoma cells in vitro and in vivo. Mol Cancer Ther 2002;1:989–97.
    OpenUrlAbstract/FREE Full Text
  31. ↵
    Semba S, Itoh N, Ito M, Harada M, Yamakawa M. The in vitro and in vivo effects of 2-(4-morpholinyl)-8-phenyl-chromone (LY294002), a specific inhibitor of phosphatidylinositol 3′-kinase, in human colon cancer cells. Clin Cancer Res 2002;8:1957–63.
    OpenUrlAbstract/FREE Full Text
  32. ↵
    Huang S, Houghton PJ. Inhibitors of mammalian target of rapamycin as novel antitumor agents: from bench to clinic. Curr Opin Investig Drugs 2002;3:295–304.
    OpenUrlPubMed
  33. ↵
    Sekulic A, Hudson CC, Homme JL, et al. A direct linkage between the phosphoinositide 3-kinase-AKT signaling pathway and the mammalian target of rapamycin in mitogen-stimulated and transformed cells. Cancer Res 2000;60:3504–13.
    OpenUrlAbstract/FREE Full Text
  34. ↵
    Basso AD, Solit DB, Munster PN, Rosen N. Ansamycin antibiotics inhibit Akt activation and cyclin D expression in breast cancer cells that overexpress HER2. Oncogene 2002;21:1159–66.
    OpenUrlCrossRefPubMed
  35. ↵
    Meuillet EJ, Mahadevan D, Vankayalapati H, et al. Specific inhibition of the Akt1 pleckstrin homology domain by d-3-deoxy-phosphatidyl-myo-inositol analogues. Mol Cancer Ther 2003;2:389–99.
    OpenUrlAbstract/FREE Full Text
  36. ↵
    Martelli AM, Tazzari PL, Tabellini G, et al. A new selective AKT pharmacological inhibitor reduces resistance to chemotherapeutic drugs, TRAIL, all-trans-retinoic acid, and ionizing radiation of human leukemia cells. Leukemia 2003;17:1794–805.
    OpenUrlCrossRefPubMed
  37. ↵
    Yang L, Dan HC, Sun M, et al. Akt/protein kinase B signaling inhibitor-2, a selective small molecule inhibitor of Akt signaling with antitumor activity in cancer cells overexpressing Akt. Cancer 2004;64:4394–9.
    OpenUrlAbstract/FREE Full Text
  38. ↵
    Shen J, Smith RA, Stoll VS, et al. Characterization of protein kinase A phosphorylation: multi-technique approach to phosphate mapping. Anal Biochem 2004;324:204–18.
    OpenUrlCrossRefPubMed
  39. ↵
    Engh RA, Girod A, Kinzel V, Huber R, Bossemeyer D. Crystal structures of catalytic subunit of cAMP-dependent protein kinase in complex with isoquinolinesulfonyl protein kinase inhibitors H7, H8, and H89: structural implications for selectivity. J Biol Chem 1996;271:26157–64.
    OpenUrlAbstract/FREE Full Text
  40. ↵
    Luo Y, Smith RA, Guan R, et al. Pseudosubstrate peptides inhibit Akt and induce cell growth inhibition. Biochemistry 2004;43:1254–63.
    OpenUrlCrossRefPubMed
  41. ↵
    Plas DR, Talapatra S, Edinger AL, Rathmell JC, Thompson CB. Akt and Bcl-xL promote growth factor-independent survival through distinct effects on mitochondrial physiology. J Biol Chem 2001;276:12041–8.
    OpenUrlAbstract/FREE Full Text
  42. ↵
    Biggs WH, Meisenhelder J, Hunter T, Cavenee WK, Arden KC. Protein kinase B/Akt-mediated phosphorylation promotes nuclear exclusion of the winged helix transcription factor FKHR1. Proc Natl Acad Sci U S A 1999;96:7421–6.
    OpenUrlAbstract/FREE Full Text
  43. ↵
    Fahy BN, Schlieman M, Virudachalam S, Bold RJ. AKT inhibition is associated with chemosensitisation in the pancreatic cancer cell line MIA-PaCa-2. Br J Cancer 2003;89:391–7.
    OpenUrlCrossRefPubMed
  44. ↵
    Nakashio A, Fujita N, Rokudai S, Sato S, Tsuruo T. Prevention of phosphatidylinositol 3′-kinase-Akt survival signaling pathway during topotecan-induced apoptosis. Cancer Res 2000;60:5303–9.
    OpenUrlAbstract/FREE Full Text
  45. Ng SS, Tsao MS, Nicklee T, Hedley DW. Wortmannin inhibits pkb/akt phosphorylation and promotes gemcitabine antitumor activity in orthotopic human pancreatic cancer xenografts in immunodeficient mice. Clin Cancer Res 2001;7:3269–75.
    OpenUrlAbstract/FREE Full Text
  46. Grünwald V, DeGraffenried L, Russel D, Friedrichs WE, Ray RB, Hidalgo M. Inhibitors of mTOR reverse doxorubicin resistance conferred by PTEN status in prostate cancer cells. Cancer Res 2002;62:6141–5.
    OpenUrlAbstract/FREE Full Text
  47. ↵
    Asselin E, Mills GB, Tsang BK. XIAP regulates Akt activity and caspase-3-dependent cleavage during cisplatin-induced apoptosis in human ovarian epithelial cancer cells. Cancer Res 2001;61:1862–8.
    OpenUrlAbstract/FREE Full Text
  48. ↵
    Mitsuuchi Y, Johnson SW, Selvakumaran M, Williams SJ, Hamilton TC, Testa JR. The phosphatidylinositol 3-kinase/AKT signal transduction pathway plays a critical role in the expression of p21(WAF1/CIP1/SDI1) induced by cisplatin and paclitaxel. Cancer Res 2000;60:5390–4.
    OpenUrlAbstract/FREE Full Text
  49. ↵
    Shingu T, Yamada K, Hara N, et al. Synergistic augmentation of antimicrotubule agent-induced cytotoxicity by a phosphoinositide 3-kinase inhibitor in human malignant glioma cells. Cancer Res 2003;63:4044–7.
    OpenUrlAbstract/FREE Full Text
  50. ↵
    Yang CC, Lin Ho P, Chen CS, et al. Bcl-xL mediates a survival mechanism independent of the phosphoinositide 3-kinase/Akt pathway in prostate cancer cells. J Biol Chem 2003;278:25872–8.
    OpenUrlAbstract/FREE Full Text
  51. ↵
    Cho H, Mu J, Kim JK, et al. Insulin resistance and a diabetes mellitus-like syndrome in mice lacking the protein kinase Akt2 (PKB β). Science 2001;292:1728–31.
    OpenUrlAbstract/FREE Full Text
  52. ↵
    Garofalo RS, Orena SJ, Rafidi K, et al. Severe diabetes, age-dependent loss of adipose tissue, and mild growth deficiency in mice lacking Akt2/PKB β. J Clin Invest 2003;112:197–208.
    OpenUrlCrossRefPubMed
PreviousNext
Back to top
Molecular Cancer Therapeutics: 4 (6)
June 2005
Volume 4, Issue 6
  • Table of Contents
  • About the Cover

Sign up for alerts

View this article with LENS

Open full page PDF
Article Alerts
Sign In to Email Alerts with your Email Address
Email Article

Thank you for sharing this Molecular Cancer Therapeutics article.

NOTE: We request your email address only to inform the recipient that it was you who recommended this article, and that it is not junk mail. We do not retain these email addresses.

Enter multiple addresses on separate lines or separate them with commas.
Potent and selective inhibitors of Akt kinases slow the progress of tumors in vivo
(Your Name) has forwarded a page to you from Molecular Cancer Therapeutics
(Your Name) thought you would be interested in this article in Molecular Cancer Therapeutics.
CAPTCHA
This question is for testing whether or not you are a human visitor and to prevent automated spam submissions.
Citation Tools
Potent and selective inhibitors of Akt kinases slow the progress of tumors in vivo
Yan Luo, Alexander R. Shoemaker, Xuesong Liu, Keith W. Woods, Sheela A. Thomas, Ron de Jong, Edward K. Han, Tongmei Li, Vincent S. Stoll, Jessica A. Powlas, Anatol Oleksijew, Michael J. Mitten, Yan Shi, Ran Guan, Thomas P. McGonigal, Vered Klinghofer, Eric F. Johnson, Joel D. Leverson, Jennifer J. Bouska, Mulugeta Mamo, Richard A. Smith, Emily E. Gramling-Evans, Bradley A. Zinker, Amanda K. Mika, Phong T. Nguyen, Tilman Oltersdorf, Saul H. Rosenberg, Qun Li and Vincent L. Giranda
Mol Cancer Ther June 1 2005 (4) (6) 977-986; DOI: 10.1158/1535-7163.MCT-05-0005

Citation Manager Formats

  • BibTeX
  • Bookends
  • EasyBib
  • EndNote (tagged)
  • EndNote 8 (xml)
  • Medlars
  • Mendeley
  • Papers
  • RefWorks Tagged
  • Ref Manager
  • RIS
  • Zotero
Share
Potent and selective inhibitors of Akt kinases slow the progress of tumors in vivo
Yan Luo, Alexander R. Shoemaker, Xuesong Liu, Keith W. Woods, Sheela A. Thomas, Ron de Jong, Edward K. Han, Tongmei Li, Vincent S. Stoll, Jessica A. Powlas, Anatol Oleksijew, Michael J. Mitten, Yan Shi, Ran Guan, Thomas P. McGonigal, Vered Klinghofer, Eric F. Johnson, Joel D. Leverson, Jennifer J. Bouska, Mulugeta Mamo, Richard A. Smith, Emily E. Gramling-Evans, Bradley A. Zinker, Amanda K. Mika, Phong T. Nguyen, Tilman Oltersdorf, Saul H. Rosenberg, Qun Li and Vincent L. Giranda
Mol Cancer Ther June 1 2005 (4) (6) 977-986; DOI: 10.1158/1535-7163.MCT-05-0005
del.icio.us logo Digg logo Reddit logo Twitter logo CiteULike logo Facebook logo Google logo Mendeley logo
  • Tweet Widget
  • Facebook Like
  • Google Plus One

Jump to section

  • Article
    • Abstract
    • Introduction
    • Materials and Methods
    • Results
    • Discussion
    • Acknowledgments
    • Footnotes
    • References
  • Figures & Data
  • Info & Metrics
  • PDF
Advertisement

Related Articles

Cited By...

More in this TOC Section

  • Prediction of individual response to platinum/paclitaxel combination using novel marker genes in ovarian cancers
  • Low doses of cisplatin or gemcitabine plus Photofrin/photodynamic therapy: Disjointed cell cycle phase-related activity accounts for synergistic outcome in metastatic non–small cell lung cancer cells (H1299)
  • Semisynthetic homoharringtonine induces apoptosis via inhibition of protein synthesis and triggers rapid myeloid cell leukemia-1 down-regulation in myeloid leukemia cells
Show more Article
  • Home
  • Alerts
  • Feedback
  • Privacy Policy
Facebook  Twitter  LinkedIn  YouTube  RSS

Articles

  • Online First
  • Current Issue
  • Past Issues
  • Meeting Abstracts

Info for

  • Authors
  • Subscribers
  • Advertisers
  • Librarians

About MCT

  • About the Journal
  • Editorial Board
  • Permissions
  • Submit a Manuscript
AACR logo

Copyright © 2021 by the American Association for Cancer Research.

Molecular Cancer Therapeutics
eISSN: 1538-8514
ISSN: 1535-7163

Advertisement