| HOME | HELP | FEEDBACK | SUBSCRIPTIONS | ARCHIVE | SEARCH | TABLE OF CONTENTS |
1 Cancer Research, 2 Structural Biology, and 3 Metabolic Disease Research, Abbott Laboratories, Abbott Park, Illinois and 4 Idun Pharmaceuticals, San Diego, California
Requests for reprints: Vincent L. Giranda, Cancer Research, Abbott Laboratories, 100 Abbott Park Road, IL 60064-6117. Phone: 847-937-0268; Fax: 847-938-2365. E-mail: vincent.giranda{at}abbott.com
 |
Abstract |
|---|
 Top Abstract IntroductionMaterials and MethodsResultsDiscussionReferences |
|---|
2-fold lower than the maximally tolerated doses. Consistent with data from knockout animals, the Akt inhibitors induce an increase in insulin secretion. They also induce a reactive increase in Akt phosphorylation. Other toxicities observed, including malaise and weight loss, are consistent with abnormalities in glucose metabolism. These data show that direct Akt inhibition may be useful in cancer therapy, but significant metabolic toxicities are likely dose limiting. |
Introduction |
|---|
|
TopAbstractIntroductionMaterials and MethodsResultsDiscussionReferences |
|---|
Akt is downstream of phosphatidylinositol 3-kinase (PI3K) and is a critical node in this signal transduction pathway. The activation of Akt by PI3K is antagonized by the tumor suppressor PTEN (9). Thus, the increased Akt activity that is observed in most human malignancies could be the result of (a) an increased Akt expression, (b) increased PI3K activity, or (c) decreased PTEN activity (10). Correlative evidence for all three of these mechanisms has been found in human tumors. Akts are overexpressed in a variety of human tumors (7, 11–13), and at the genomic level, AKT1 and AKT2 have been shown to be amplified in a number of cancer types (7). PI3K activity is increased by numerous growth factors, many of which are themselves targets for cancer therapy (e.g., KDR and HER2; refs. 14–16). PTEN mutations that result in increased Akt activity have likewise been described in a wide variety of malignancies (17–19). Alterations that increase Akt activity (e.g., PTEN loss, PI3K up-regulation, and increased Akt expression) rival alterations in the p53/p16 pathway as the most common changes found in malignant tumor cells (10, 20).
In addition to the correlative data, there is also considerable experimental evidence for the importance of PI3K, Akt, and PTEN in neoplasia. The constitutive expression of active Akts promotes tumorigenesis when these Akt-expressing clones are inoculated into nude mice (21–23). Mice heterozygous for Pten deletions, where Akt activity is dramatically increased, develop neoplasms in colon, testis, thyroid, prostate, endometrium, and liver. These animals also have an increased incidence of lymphoma and leukemia (24, 25). In humans, there are three closely related and inherited cancer syndromes caused by mutations in the PTEN locus: Cowden disease (26), Lhermitte-Duclos disease (26), and Bannayan-Zonana syndrome (27). Patients with these disorders have multiple benign tumors and greatly increased incidence of carcinomas.
In Drosophila, a germ line deletion of dAkt reverses the large cell phenotype in dPten–/– flies (28). More recently, deletion of Akt1 has been shown to reverse the aggressive growth phenotype of Pten–/– mouse embryonic stem cells (29). These data suggest the tumorigenic phenotype caused by loss of PTEN can be largely reversed by inhibition of Akt.
The prevalence of Akt activation in human tumors, coupled with the genetic experiments showing that PTEN deletions or active Akt can induce tumor formation, suggests that inhibition of Akt may be useful in the treatment of neoplastic diseases. Indeed, there have been attempts to modulate the activity of this pathway. Inhibition of PI3K directly has been reported to decrease the progression of tumors in rodents (30, 31). Likewise, using rapamycin or one of its analogues to inhibit the PI3K pathway downstream at mammalian target of rapamycin (mTOR) has been shown to reduce tumor growth in mouse models (several compounds are currently in human clinical trials; refs. 32, 33). There have also been reports of compounds that inhibit the activation of Akt [e.g., heat shock protein 90 inhibitors (34), pleckstrin homology domain inhibitors (35, 36), and others (37)]. Here we report on the discovery of potent compounds that directly inhibit the kinase activity of Akt. We also report the effects of these compounds on transformed cells in vitro as well as on tumor progression in vivo.
|
Materials and Methods |
|---|
|
TopAbstractIntroductionMaterials and MethodsResultsDiscussionReferences |
|---|
In vitro Kinase Assays
Recombinant CK2, PKC
, and PKC
(Calbiochem, San Diego, CA); PKA (Panvera, Madison, WI); cyclin-dependent kinase 2/CyclinA, GSK3ß, MAPK-AP2, Src, and RSK2 (Upstate Biotechnology, Charlottesville, VA); extracellular signal–regulated kinase 2 (New England Biolabs, Beverly, MA), cKit (544-976; ProQinase, Freiburg, Germany) were commercially obtained. His-tagged Akt1 (S378A, S381A, T450D, S473D; 139-480), Chk1 (1-269), KDR (789-1354), Flt-1 (786-1338), and phosphatidylinositide-dependent kinase 1 (1-396), were expressed using the FastBac bacculovirus expression system (Life Technologies, Gaithersburg, MD) and purified using either nickel (his-tag) or glutathione S-transferase affinity chromatography. Peptides substrates had the general structure biotin-Ahx-peptide with the following sequences: Akt, EELSPFRGRSRSAPPNLWAAQR; PKA, LRRASLG; PKC and PKC, ERMRPRKRQGSVRRRV; CK2, RRADDSDDDDD; cyclin-dependent kinase 2, LPPCSPPKQGKKENGPPHSHTLKGRRAAFDNQL; GSK3ß, YRRAAVPPSPSLSRHSSPHQS(p)EDEEE; MAPK-AP2, KKLNRTLSVA; RSK2, KKKNRTLSVA; extracellular signal–regulated kinase 2, KRELVEPLTPSGEAPNQALLR; Chk1, AKVSRSGLYRSPSMPENLNRPR; phosphatidylinositide-dependent kinase 1, [protein fragment, 39 aa]; KDR, Flt-1, and cKit, AEEEYFFLFA-amide. For Src assays, the biotinylated substrate PTK-2 (Promega, Madison, WI) was used. Inhibition of kinase activity was assessed using a radioactive FlashPlate-based assay platform as previously described (40).
Alamar Blue Cell Viability Assay
The cells on 96-well plates were gently washed with 200 µL of PBS. Alamar Blue reagent (Biosource International, Carmarillo, CA) was diluted 1:10 in normal growth media. The diluted Alamar Blue reagent (100 µL) was added to each well on the 96-well plates and incubated until the reaction was complete as per manufacturer's instructions. Analysis was done using an fmax Fluorescence Microplate Reader (Molecular Devices, Sunnyvalle, CA), set at the excitation wavelength of 544 nm and emission wavelength of 595 nm. Data were analyzed using SOFTmax PRO software provided by the manufacturer.
Protein Extraction and Western Blot Analysis
Cells were treated with 0 to 30 µmol/L of Akt inhibitors for 2 hours. All drug samples were adjusted to contain equal volumes of the vehicle (DMSO). Cells were harvested, sonicated for 5 minutes in ice-cold insect cell lysis buffer [BD PharMingen, San Diego, CA; 10 mmol/L Tris-HCl (pH 7.5), 130 mmol/l NaCl, 1% Triton X-100, 10 mmol/L NaF, 10 mmol/L NaPi, 10 mmol/L NaPPi and 1 µg/mL microcyctin LR plus the protease inhibitors aprotinin (10 µg/mL), leupeptin (10 µg/mL), and phenylmethylsulfonyl fluoride (1 mmol/L)], and centrifuged at 15,300 rpm for 10 minutes. The concentrations of the total lysate protein were determined using a standard Bradford assay (Bio-Rad, San Diego, CA).
MiaPaCa-2 pancreatic tumor–bearing mice were treated with control vehicle or A-443654 at 7.5 or 75 mpk for 2 hours. Tumors were isolated and immediately frozen in liquid nitrogen. Frozen tumor tissues were sliced in thin sections and resuspended in 500 µL of lysis buffer. This suspension was homogenized with a Polytron PT 1200C (Kinematica AG, Luzern, Switzerland) for 2 minutes. The homogenized tissues were centrifuged at 15,300 rpm for 10 minutes, supernatants were collected, and the protein concentrations were determined with the Bradford method.
For Western blot analysis, 40 µg of protein from the total cell lysate were electrophoresed by SDS-PAGE. The proteins were then electrotransfered onto immobilon-P membranes (Millipore, Bedford, MA), using transfer buffer (25 mmol/L Tris, 190 mmol/L glycine, and 10% methanol). Membranes were treated with blocking buffer (50 mmol/L Tris, 200 mmol/L NaCl, 0.2% Tween 20, 5% nonfat dry milk) for 1 hour at room temperature and incubated with 1:1,000 dilution of antibodies (phospho-GSK3 
/ß Ser21/9, phospho-TSC2 Thr1462, phospho-FOXO1A/3A Thr24/32, phospho-ribosomal protein S6 Ser235/236 phospho-Akt1 Ser473, and phospho-mTOR Ser2448; all from Cell Signaling Technology, Beverly, MA) for 16 hours at 4°C. After washing with blocking buffer without 5% nonfat dry milk (washing buffer) for 30 minutes, the membranes were incubated with horseradish peroxidase–linked anti-rabbit donkey serum (1:1,000; Amersham, Arlington Heights, IL) for 1 hour. Membranes were then washed with washing buffer and immune detection was done using the enhanced chemiluminescence Western blotting detection system (Amersham). Quantitation of Western blots was done using a phospho-imager (Amersham Biosciences, Piscataway, NJ).
FL5.12 Akt1-, Akt2-, or Akt3- Overexpressing Cell Lines
Stable transfectants of FL5.12 cells expressing full-length human Akt1, Akt2, or Akt3 were generated by electroporation with a pCIneo plasmid (Promega) containing Akt cDNAs with an NH2-terminal HA-tag (41). Single clones were isolated by limiting dilution and selection for G418 resistance (Invitrogen, Carlsbad, CA). Expression was confirmed by immunoblotting with Akt isoform-specific antibodies. FL5.12/Akt cell lines were maintained in RPMI 1640 supplemented with 10% fetal bovine serum, 10% WEHI-3B conditioned medium as a source of IL-3, nonessential amino acids, 1 mmol/L sodium pyruvate, 2 mmol/L glutamine, 50 µmol/L ß-mercaptoethanol, 50 µg/mL G418, and 2.5 mmol/L HEPES (pH 7.5) at 37°C in a humidified atmosphere containing 5% CO2.
FOXO3A Translocation Assay
The pFOXO3A-hrGFP construct was engineered by inserting a FOXO3A fragment encoding NH2-terminal amino acids 1 to 400 into plasmid phrGFP (Stratagene, La Jolla, CA) using standard PCR and DNA recombinant techniques. This sequence includes the nuclear import and export signals and Akt phoshorylation sites (42). HeLa cells were plated into 6-well plates at a density of 0.3 x 106 cells per well and incubated at 37°C at 5% CO2 over night. Cells were transiently transfected with pFOXO3A-hrGFP plasmid using Effectene (Qiagen, Valencia, CA). At 40 hours post-transfection, cells were treated with compounds added to culture medium lacking phenol red. Equal amounts of DMSO were added to cells to a final concentration of 0.5%. After 6 hours, images of fluorescent live cells were captured by microscopy.
Tumor Efficacy Studies
Animal studies were conducted following the guidelines of the internal Institutional Animal Care and Use Committee. Immunocompromised male scid mice (C.B-17-Prkdcscid) were obtained from Charles River Laboratories (Wilmington, MA) at 6 to 8 weeks of age. MiaPaCa-2 and PC-3 cells were obtained from the American Type Culture Collection (Manassas, VA). The 3T3-Akt1 cell line was developed and characterized in our laboratory (23). The 1 x 106 3T3-Akt1 or 2 x 106 MiaPaCa-2 and PC-3 cells in 50% Matrigel (BD Biosciences, Bedford, MA) were inoculated s.c. into the flank. For early treatment studies, mice were randomly assigned to treatment groups and therapy was initiated the day after inoculation. Ten animals were assigned to each group, including controls. For established tumor studies, tumors were allowed to reach a designated size and mice were assigned to treatment groups of equal tumor size (n = 10 mice per group). Tumor size was evaluated by twice weekly measurements with digital calipers. Tumor volume was estimated using the formula: V = L x W2 / 2. A-443654 was given s.c. in a vehicle of 0.2% HPMC. A-674563 was given orally in a vehicle of 5% dextrose. Gemcitabine and paclitaxel were obtained from Eli Lilly and Company (Indianapolis, IN) and Bristol-Myers Squibb Co. (Princeton, NJ), respectively, and given according to the manufacturers' guidelines.
For the determination of plasma drug concentrations, proteins were precipitated with two volumes of acidified methanol. Tissue samples were taken from the same animals and homogenized with 2 volumes of saline, then precipitated with 2 volumes of acetonitrile. Precipitated proteins were removed by centrifugation and supernatants were stored at –20°C until analysis by UV-liquid chromatography or liquid chromatography-mass spectrometry. Plasma and tissue extracts were injected directly on a C18 reversed phase column (YMC-AQ 5 µ; Waters Co., Milford, MA) and eluted using combinations of acetonitrile, methanol and 8 mmol/L triethylamine acetate buffer (pH 4) with UV detection (Shimadzu 10A/VP, Shimadzu Scientific, Columbia, MD) or with acetonitrile and 0.1% acetic acid in water for mass spectrometer analysis (LCQ Duo, Thermoquest, San Jose, CA). Pharmacokinetic variables were calculated using WinNonlin software.(Pharsight Co., Mountain View, CA).
Immunohistochemistry
3T3-Akt1 and MiaPaCa-2 tumors were fixed for 48 hours in Streck Tissue Fixative (Streck Laboratories, Omaha, NE), processed, and embedded in paraffin; 5-µm tissue sections were blocked with streptavidin/biotin complex followed by 0.3% bovine serum albumin before incubation with primary antibody (caspase-3: rabbit anti-active Caspase-3 at 1:400, BD PharMingen; phospho-Akt: rabbit anti-phospho-Akt at 1:200, Cell Signaling Technology) for 1 hour at room temperature. Secondary antibody was used at 1:250 to 300 followed by streptavidin-biotin horseradish peroxidase and 3,3'-diaminobenzidine color development.
|
Results |
|---|
|
TopAbstractIntroductionMaterials and MethodsResultsDiscussionReferences |
|---|
|
In vitro Activity
A-443654 is a pan Akt inhibitor and has equal potency against Akt1, Akt2, or Akt3 within cells (Fig. 2). A-443654 is, however, very selective for Akt versus other kinases (Table 1). It is the least selective towards several closely related kinases in the AGC family, including PKA and protein kinase C (PKC). Even so, A-443654 is 40-fold selective for Akt over PKA. A-674563 is somewhat less selective, particularly against the cyclin-dependent kinases in the CMGC family. However, in spite of the selectivity differences between these two classes of Akt inhibitors, their behavior is similar in cells and in vivo (see below).
|
|
/ß, FOXO3, TSC2, and mTOR were measured as an indication of Akt activity within cells. The Akt inhibitors reduced the phosphorylation of all of these proteins in a dose-dependent fashion (Fig. 3A). As expected, we also observed that FOXO3 translocates into the nucleus upon the reversal of its phosphorylation induced by Akt inhibition (Fig. 3B). Phosphorylation of signaling molecules further downstream in the Akt pathway, such as the S6 protein, was also reduced by the Akt inhibitors.
|
To investigate the effects of Akt inhibition on cell proliferation, we did an 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide assay. The Akt inhibitors slowed proliferation of tumor cells with an EC50 of 0.1 µmol/L for A-443654 and 0.4 µmol/L for A-674563 (Fig. 3C).
In vivo Antitumor Activity
We tested both A-443654 and A-674563 for their ability to inhibit tumor growth in vivo (Fig. 4). A-443654 is more potent and more selective than A-674563 but is not available orally. Furthermore, the length of time A-443654 can be given is limited to 14 days due to severe injection site irritation. Nevertheless, in spite of the differences between these compounds, both compounds behave similarly in vivo.
|
In all models tested, the tumors rapidly regrew after compound administration was stopped. The cytostatic behavior of the inhibitors suggests that continuous dosing may lead to increased efficacy. The number of consecutive days the orally available compounds could be dosed, unlike the parenteral compounds, was not limited by injection site toxicity. Nevertheless, the oral compounds could only be given for 15 to 25 days, after which time the animals became moribund. In all cases, the compounds were given at their respective maximally tolerated doses.
Activation of the Akt pathway is thought to inhibit apoptosis induced by a variety of cytotoxic agents and has been reported to be an effective survival mechanism in many tumor cells (44–47). Therefore, we attempted to combine the Akt inhibitors with the antimitotic agent paclitaxel in a PC-3 xenograft model (48, 49). PC-3 is a PTEN-deficient human prostate carcinoma cell line, where resistance to chemotherapeutic agents is at least partially dependent on Akt activity (50). When given in combination, A-674563 increased the efficacy of paclitaxel in a PC-3 xenograft model (Fig. 4C).
We tested the pharmacokinetics and pharmacodynamics to insure that we were inhibiting Akt in vivo (Fig. 5). When the inhibitors were given at their maximally tolerated doses on a twice daily (bid) schedule, their concentration in plasma remained above the cellular EC50 for 5 hours (Fig. 5A). Concentrations in tumors were significantly higher than those in plasma, and drug concentrations in tumor remained above the cellular EC50 for the entire 12-hour dosing interval (Fig. 5B). In the tumors, as we have seen in the cellular assays, the inhibition of GSK3 and S6 phosphorylation are inhibited in a dose responsive manner by the Akt inhibitors (Fig. 5C). As also seen in the cellular studies, the increase in Akt phosphorylation seems the most sensitive marker for Akt inhibition. This suggests that the cells, in vivo, are also sensitive to Akt inhibition, and attempt to compensate for the loss of the activity.
|
As seen in Fig. 5C, doses near the MTD do not maximally inhibit Akt within tumors. Furthermore, drug washout studies in cells suggested that compounds were more effective at inducing apoptosis when maintained above their cellular EC50 for at least 12 hours (data not shown). As stated above, the plasma concentrations of A-443654 fall below this EC50 after about 5 hours. In an attempt to increase the efficacy of A-443654 by intensifying the dosing regime, the compound was given thrice in a single day, 3 hours apart, for a total of 50 mg/kg/d. The animals could not tolerate 50 mg/kg/d every day; thus, compound was given every fourth day. This regime maintains the plasma concentrations of A-443654 above its cellular EC50 for >12 hours. This thrice daily (tid)/q4d schedule proved to be more efficacious than the bid/daily schedule (Fig. 4D). Note that for the tid schedule, dosing was started on established tumors whereas for the bid schedule dosing was started immediately after tumor cell inoculation. Similar to what was observed with the bid/daily schedule, when treated on the tid/q4d schedule, the tumors regrew soon after dosing was stopped.
Akt inhibition was compared with inhibition further downstream in the PI3K pathway at mTOR, using rapamycin (Fig. 4D). When dosed, both the Akt inhibitors and rapamycin are efficacious in the MiaPaCa-2 model. However, rapamycin is significantly less toxic and has a much larger therapeutic window than the Akt inhibitors. Furthermore, rapamycin therapy can be maintained longer, leading to more durable responses. The function of mTOR in tumor progression does not seem completely epistatic to that of Akt, as the efficacy observed for the combination of the Akt and mTOR inhibitors was better than that observed for either agent alone.
Metabolic Consequences of Akt Inhibition
Akt is downstream of the insulin receptor and transduces the insulin response in vivo. We therefore measured blood sugar and insulin responses related to the inhibition of Akt. We examined random blood sugars during multiple tumor studies and have never observed any differences between the treated and control groups. We also measured both blood sugar and plasma insulin levels in glucose challenge tests. Blood sugars were not changed upon administration of Akt inhibitors, even when supertherapeutic doses were given (data not shown). We did, however, observe significant increases in plasma insulin following administration of a single dose of Akt inhibitors at therapeutic doses (Fig. 5F). This data is consistent with a homeostatic response, where the animals increase insulin secretion to maintain blood glucose concentrations. This is also what has been observed in Akt2 knockout animals (51, 52). When young, these animals have normal blood sugars but increased plasma insulin. Only when older, after islet cell failure, do the animals lose their ability to maintain normal blood glucose concentrations.
While determining the maximum tolerated dose, we found that the Akt inhibitors induce a dose- and time-dependent weight loss in treated animals. This weight loss is typically >10% of total body mass when compounds are given at thrice their maximum tolerated dose (data not shown). Whereas weight loss is a general toxicity, it is consistent with the expectation that the compounds may interfere with the utilization of glucose by interfering with the insulin pathway.
|
Discussion |
|---|
|
TopAbstractIntroductionMaterials and MethodsResultsDiscussionReferences |
|---|
The dose-limiting toxicities for the oral compounds, malaise and weight loss, are consistent with a mechanism-based toxicity, where the inhibitors interfere with the metabolism of glucose (the limiting toxicity for parenteral compounds is an injection site irritation). However, weight loss is a general toxicity seen with many anticancer agents that do not inhibit Akt. Also consistent with mechanism-based toxicity is the observation that compounds with substantially different selectivity profiles, but similar Akt inhibitory activity, elicit the same types of toxicity. The increase in plasma insulin attendant with Akt inhibition also suggests metabolic toxicities may be dose limiting. Further studies with more widely divergent Akt inhibitors will be required to ascertain if Akt inhibition as cancer therapy will be limited by mechanism-based metabolic toxicities.
Whereas the efficacy observed in the tumor models is promising, it is clear that inhibition of Akt as a therapy for cancer would benefit from a widening of the therapeutic window. A number of active investigations are under way to further improve the therapeutic window. The inhibitors described here are pan-Akt inhibitors, and in cells have equal potency inhibiting Akt1, Akt2, or Akt3 within cells. Akt2 loss seems to predominate in toxicity related to insulin signaling (51, 52), whereas Akt1 has been reported to be more important in cancer cell survival. Thus, generation of inhibitors more selective for Akt1 over Akt2 might improve therapeutic window. Furthermore, it is clear from the paclitaxel study that Akt inhibitors may collaborate with chemotherapeutics that induce apoptosis. Akt has recently been shown to collaborate with Bcl2/BclXL in several cell lines to inhibit apoptosis in cancer cells (50). Thus, using these Akt inhibitors with other agents may produce the desired improvement in therapeutic window by improving efficacy without increasing toxicity.
Finally, the Akt inhibitors, along with rapamycin, illustrate that different nodes in the PI3K signal transduction pathway can be inhibited to slow tumor progression. The efficacy of the Akt and mTOR inhibitors suggests that, as monotherapy, other inhibitors of the PI3K pathway will also be efficacious. However, the differences in toxicity suggest that inhibiting at different nodes in the PI3K pathway might yield very different therapeutic windows. There are a number of potential targets in this pathway, including PI3K, phosphatidylinositide-dependent kinase 1, ILK, Akt1, Akt2, Akt3, mTOR, p70S6K, and 4E-BP1, all of which are under investigation for utility in human cancer therapy. The results of these investigations will ultimately determine where to target the PI3K pathway to provide the best efficacy and therapeutic window for the treatment of cancer.
|
Acknowledgments |
|---|
|
Footnotes |
|---|
Grant support: R. de Jong is currently at the Syrrx, Inc., 10410 Science Center Drive, San Diego, CA 92121.
Received 1/ 6/05; revised 3/16/05; accepted 4/11/05.
|
References |
|---|
|
TopAbstractIntroductionMaterials and MethodsResultsDiscussionReferences |
|---|
) which contains the regulatory serine phosphorylation site. Biochem Biophys Res Commun 1999;257:906–10.[CrossRef][Medline]
Masure S, Haefner B, Wesselink JJ, et al. Molecular cloning, expression and characterization of the human serine/threonine kinase Akt-3. Eur J Biochem 1999;265:353–60.[Medline]
Staal SP. Molecular cloning of the akt oncogene and its human homologues AKT1 and AKT2: amplification of AKT1 in a primary human gastric adenocarcinoma. Proc Natl Acad Sci U S A 1987;84:5034–7. kinase is frequently elevated in human cancers and its constitutive activation is required for oncogenic transformation in NIH3T3 cells. Am J Pathol 2001;159:431–7. in PTEN-controlled tumorigenesis. Mol Cell Biol 2002;22:3842–51.This article has been cited by other articles:
|
|
 |
|
  A. Nakamura, M. Naito, T. Tsuruo, and N. Fujita Freud-1/Aki1, a Novel PDK1-Interacting Protein, Functions as a Scaffold To Activate the PDK1/Akt Pathway in Epidermal Growth Factor Signaling Mol. Cell. Biol., October 1, 2008; 28(19): 5996 - 6009. [Abstract] [Full Text] [PDF]
|
|
|
|
 |
|
 F. Fala, W. L. Blalock, P. L. Tazzari, A. Cappellini, F. Chiarini, G. Martinelli, A. Tafuri, J. A. McCubrey, L. Cocco, and A. M. Martelli Proapoptotic Activity and Chemosensitizing Effect of the Novel Akt Inhibitor (2S)-1-(1H-Indol-3-yl)-3-[5-(3-methyl-2H-indazol-5-yl)pyridin-3-yl]oxypropan2-amine (A443654) in T-Cell Acute Lymphoblastic Leukemia Mol. Pharmacol., September 1, 2008; 74(3): 884 - 895. [Abstract] [Full Text] [PDF]
|
|
|
|
 |
|
 Q.-S. Zhu, W. Ren, B. Korchin, G. Lahat, A. Dicker, Y. Lu, G. Mills, R. E. Pollock, and D. Lev Soft Tissue Sarcoma Cells Are Highly Sensitive to AKT Blockade: A Role for p53-Independent Up-regulation of GADD45{alpha} Cancer Res., April 15, 2008; 68(8): 2895 - 2903. [Abstract] [Full Text] [PDF]
|
|
|
|
 |
|
 A. Vaid, D. C. Thomas, and P. Sharma Role of Ca2+/Calmodulin-PfPKB Signaling Pathway in Erythrocyte Invasion by Plasmodium falciparum J. Biol. Chem., February 29, 2008; 283(9): 5589 - 5597. [Abstract] [Full Text] [PDF]
|
|
|
|
 |
|
 M. Herling, K. A. Patel, M. A. Teitell, M. Konopleva, F. Ravandi, R. Kobayashi, and D. Jones High TCL1 expression and intact T-cell receptor signaling define a hyperproliferative subset of T-cell prolymphocytic leukemia Blood, January 1, 2008; 111(1): 328 - 337. [Abstract] [Full Text] [PDF]
|
|
|
|
 |
|
 L. Toral-Barza, W.-G. Zhang, X. Huang, L. A. McDonald, E. J. Salaski, L. R. Barbieri, W.-D. Ding, G. Krishnamurthy, Y. B. Hu, J. Lucas, et al. Discovery of lactoquinomycin and related pyranonaphthoquinones as potent and allosteric inhibitors of AKT/PKB: mechanistic involvement of AKT catalytic activation loop cysteines Mol. Cancer Ther., November 1, 2007; 6(11): 3028 - 3038. [Abstract] [Full Text] [PDF]
|
|
|
|
|
|
J. A. Crowell, V. E. Steele, and J. R. Fay Targeting the AKT protein kinase for cancer chemoprevention Mol. Cancer Ther., August 1, 2007; 6(8): 2139 - 2148. [Abstract] [Full Text] [PDF]
|
|
|
|
 |
|
 A. Albini, D. M. Noonan, and N. Ferrari Molecular Pathways for Cancer Angioprevention Clin. Cancer Res., August 1, 2007; 13(15): 4320 - 4325. [Abstract] [Full Text] [PDF]
|
|
|
|
 |
|
 Y. Luo, C. J. Dixon, J. F. Hall, P. J. White, and M. R. Boarder A Role for Akt in Epidermal Growth Factor-Stimulated Cell Cycle Progression in Cultured Hepatocytes: Generation of a Hyperproliferative Window after Adenoviral Expression of Constitutively Active Akt J. Pharmacol. Exp. Ther., June 1, 2007; 321(3): 884 - 891. [Abstract] [Full Text] [PDF]
|
|
|
|
|
|
R. T. Kurmasheva, F. C. Harwood, and P. J. Houghton Differential regulation of vascular endothelial growth factor by Akt and mammalian target of rapamycin inhibitors in cell lines derived from childhood solid tumors Mol. Cancer Ther., May 1, 2007; 6(5): 1620 - 1628. [Abstract] [Full Text] [PDF]
|
|
|
|
|
|
S. V. Madhunapantula, A. Sharma, and G. P. Robertson PRAS40 Deregulates Apoptosis in Malignant Melanoma Cancer Res., April 15, 2007; 67(8): 3626 - 3636. [Abstract] |
), Akt2 (
), or Akt3 (
). There is no appreciable phosphorylation of GSK3 in the parental cell lines, whereas there are high levels of phospho-GSK3 (P-GSK3) observed in all three Akt overexpressing lines. A-443654 reduces the P-GSK3 in a dose-responsive manner in all three cell lines. The broad-spectrum kinase inhibitor staurosporine was added at 1 µmol/L as a positive control. The P-GSK3 was quantitated and normalized to the total GSK3. Plot of the resulting inhibition for each overexpressing cell line (right).
), A-443654 at 7.5mg/kg/d (
). Therapy was initiated 21 d after tumor inoculation when the mean tumor volume of each group was 
); s.c. vehicle (
), or 20 mg/kg A-443654 (